PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008221488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 335aa    MW: 36060.1 Da    PI: 10.0314
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008221488.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_008221488.1  94 AWTEEEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 138
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.108.9E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.763520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.08287143IPR017930Myb domain
SuperFamilySSF466898.22E-1789144IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-1790141IPR006447Myb domain, plants
SMARTSM007173.9E-1091141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-1193138IPR009057Homeodomain-like
PfamPF002497.6E-1194138IPR001005SANT/Myb domain
CDDcd001674.05E-994139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MSRTCSQCGN NGHNSRTCTE ASGGSGGAAS AENGIMLFGV RVTEGNAFRK SASMNNISQY  60
EQNLQADSNG DAGYASDDVV HASGHRRERK RGVAWTEEEH RLFLLGLQKV GKGDWRGISR  120
NFVKTRTPTQ VASHAQKYFL RRNNHNRRRR RSSLFDITTD APLMNSLMDE DIGQQKHQET  180
ATALPYPQQP QAQMNLGRHI LGGFPVSTFT MALSPGVLPV SGETSSVDNL TSSIGPNLNL  240
QSEVLQQAKG APTTLSAKLI RPIPLHPVPP PPSSKMAGHN LNNKYTPPPT RDPSPLSLKL  300
ATTSSSEEQS PNTASSHSSA FQGMSSGSDS IISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008221488.10.0PREDICTED: transcription factor MYB1R1
TrEMBLM5XEE60.0M5XEE6_PRUPE; Uncharacterized protein
STRINGVIT_01s0026g01050.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-72MYB_related family protein